Cart summary

You have no items in your shopping cart.

ZNF454 Rabbit Polyclonal Antibody (Biotin)

ZNF454 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2132072

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2132072
CategoryAntibodies
DescriptionZNF454 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZNF454
Protein SequenceSynthetic peptide located within the following region: WTIKERFSSSSHWKCASLLEWQCGGQEISLQRVVLTHPNTPSQEYDESGS
UniProt IDQ8N9F8
MW60kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesFLJ37444, MGC138481
NoteFor research use only
NCBINP_872400