Cart summary

You have no items in your shopping cart.

ZNF318 Rabbit Polyclonal Antibody (FITC)

ZNF318 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2139818

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2139818
CategoryAntibodies
DescriptionZNF318 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZNF318
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW232kDa
UniProt IDQ5VUA4
Protein SequenceSynthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH
NCBINP_055160
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesTZF, ZFP318, HRIHFB2436
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.