Cart summary

You have no items in your shopping cart.

ZNF141 Rabbit Polyclonal Antibody (FITC)

ZNF141 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2129214

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2129214
CategoryAntibodies
DescriptionZNF141 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZNF141
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW55kDa
UniProt IDQ15928
Protein SequenceSynthetic peptide located within the following region: KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH
NCBINP_003432
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesD4S90, pHZ-44
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.