You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2000247 |
---|---|
Category | Proteins |
Description | ZDHHC9 Peptide - middle region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 40 kDa |
UniProt ID | Q9Y397 |
Protein Sequence | Synthetic peptide located within the following region: EDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEES |
NCBI | NP_001008223.1 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | CGI89, DHHC9, MMSA1, MRXSZ, ZNF379, ZNF380, CXorf1 Read more... |
Note | For research use only |
Application notes | This is a synthetic peptide designed for use in combination with ZDHHC9 Rabbit Polyclonal Antibody (orb589561). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Expiration Date | 6 months from date of receipt. |