ZFP67 Rabbit Polyclonal Antibody

• Catalog Number: orb324428
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB7B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFP67
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: ZBTB7B
• UniProt ID: O15156
• Protein Sequence: Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
• NCBI: NP_056956
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti THPOK antibody, anti ZFP67 antibody, anti ZBT
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

Human Heart

Human Lung

WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0 ug/mL, Positive Control: HepG2 cell lysate.