ZBTB7B antibody

• Catalog Number: orb324428
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB7B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFP67
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: ZBTB7B
• UniProt ID: O15156
• Protein Sequence: Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
• NCBI: NP_056956
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti THPOK antibody, anti ZFP67 antibody, anti ZBT
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using ZBTB7B antibody

Immunohistochemical staining of human Lung tissue using ZBTB7B antibody

Immunohistochemical staining of human Heart tissue using ZBTB7B antibody

Western blot analysis of human Fetal Liver tissue using ZBTB7B antibody

Western blot analysis of HepG2 tissue using ZBTB7B antibody