You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587803 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to XKR8 |
Target | XKR8 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human XKR8 |
Protein Sequence | Synthetic peptide located within the following region: CWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG |
UniProt ID | Q9H6D3 |
MW | 43 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | XRG8, hXkr8 |
Research Area | Apoptotic, Cancer, Neuroscience, Signaling Pathway Read more... |
Note | For research use only |
NCBI | NP_060523 |
Expiration Date | 12 months from date of receipt. |
Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |