You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1476743 |
---|---|
Category | Proteins |
Description | Recombinant Lake Victoria marburgvirus Polymerase cofactor VP35(VP35) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 40.2 kDa |
UniProt ID | P35259 |
Protein Sequence | MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPSQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI |
Protein Length | Full Length |
Source | E.coli |
Expression System | Expression Region: 1-329aa. Protein Length: Full Length |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | (Marburg VP35)(mVP35) Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
31.8 kDa | |
Ebolavirus (subtype Bundibugyo, strain Uganda 2007) GP1 Protein, His Tag (orb257224) is expressed from human 293 cells (HEK293). It contains AA Ile 33 - Gln 304 (Accession # ACI28624). |
Unconjugated | |
95% | |
34.3 kDa | |
Ebolavirus BDBV (subtype Bundibugyo, strain Uganda 2007) sGP Protein, His Tag (orb257223) is expressed from human 293 cells (HEK293). It contains AA Ile 33 - Arg 324 (Accession # B8XCN1). |
Unconjugated | |
85% | |
67.2 kDa | |
Ebolavirus EBOV (subtype Zaire, strain Kikwit-95) GP, His Tag (orb257934) is expressed from human 293 cells (HEK293). It contains AA Ile 33 - Asp 637 (Accession # AAQ55048.1). |
Unconjugated | |
95% | |
52.0 kDa | |
Ebolavirus EBOV (subtype Zaire, strain Kikwit-95) GP1, His Tag (orb257933) is expressed from human 293 cells (HEK293). It contains AA Ile 33 - Arg 501 (Accession # AAQ55048.1). |
Filter by Rating