Virus VACWR156 protein

SKU: orb605406

Description

This Virus VACWR156 protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Yeast
• Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
• Tag: N-terminal 6xHis-tagged
• Expression Region: 57-185aa
• Protein Length: Partial
• MW: 16.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

VACWR156, A33RProtein A33

Quick Database Links

UniProt

P68617