You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605406 |
---|---|
Category | Proteins |
Description | Recombinant Vaccinia virus Protein A33(VACWR156),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 16.2 kDa |
UniProt ID | P68617 |
Protein Sequence | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
Protein Length | Partial |
Source | Yeast |
Biological Origin | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
Expression Region | 57-185aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | VACWR156, A33RProtein A33 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) VACWR156.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) VACWR156.