Virus US12 protein

• Catalog Number: orb604710
• Category: Proteins
• Description: Recombinant Herpes simplex virus type 2 ICP47 protein(US12)
• Tag: N-terminal 6xHis-KSI-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 85% as determined by SDS-PAGE.
• MW: 23.9 kDa
• UniProt ID: P60504
• Protein Sequence: MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP
• Protein Length: Full Length
• Source: E.coli
• Biological Origin: Herpes simplex virus type 2 (strain SA8) (Simian agent 8)
• Expression Region: 1-78aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Immediate-early protein IE12 (Immediate-early-5) (
• Note: For research use only
• Application notes: Full Length
• Expiration Date: 6 months from date of receipt.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.