You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Virus omp25 protein
Catalog Number: orb604940
| Catalog Number | orb604940 |
|---|---|
| Category | Proteins |
| Description | Recombinant Brucella abortus biovar 1 25 kDa outer-membrane immunogenic protein(omp25) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q44664 |
| MW | 27.8 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Brucella abortus biovar 1 (strain 9-941) |
| Expression Region | 24-213aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | omp25, BruAb1_0720, 25 kDa outer-membrane immunoge Read more... |
| Note | For research use only |
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.
