You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Virus F protein
Catalog Number: orb604715
| Catalog Number | orb604715 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0(F),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT |
| Protein Length | Extracellular Domain |
| UniProt ID | P03420 |
| MW | 58.9 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Human respiratory syncytial virus A (strain A2) |
| Expression Region | 27-529aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Protein F |
| Note | For research use only |
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain A2) F.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain A2) F.
- Item 1 of 3
Human Fusion glycoprotein F0 protein [orb419334]
Greater than 90% as determined by SDS-PAGE.
69.9 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
- Item 1 of 2
- Item 1 of 1
Human F protein [orb246832]
Greater than 90% as determined by SDS-PAGE.
57.9 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Canine F protein [orb244661]
Greater than 90% as determined by SDS-PAGE.
67.5 kDa
E.coli
20 μg, 100 μg, 1 mg
