You have no items in your shopping cart.
VIP, guinea pig
SKU: orb2694965
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 3344.93 |
| Protein Sequence | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−- Item 1 of 1
Guinea pig Vasoactive Intestinal Peptide (VIP) ELISA Kit [orb780897]
Guinea pig
7.82-500 pg/mL
2.42 pg/mL
96 T, 48 T - Item 1 of 1
Vasoactive Intestinal Peptide, guinea pig [orb746834]
≥95%
96886-24-7
3344.93
C147H239N43O42S2
2.5 mg, 1 mg, 0.5 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
VIP, guinea pig (orb2694965)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days