Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 5-10 working days
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00
Product Overview
| Product Name | VEGF C protein |
|---|---|
| Catalog Number | orb429181 |
| Conjugation | Unconjugated |
| Target | VEGF C |
Product Properties
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer. |
|---|---|
| Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Note | For research use only. |
| Protein Sequence | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH. |
| Purity | >90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Source | Sf9, Insect Cells. |
| Activity | Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg. |
Product Description
Recombinant of VEGF C protein
Solubility (25°C)
| Solubility (25°C) | It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
|---|
Reviews
Write Your Own Review
