Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

VEGF C Protein

SKU: orb429181

Description

Recombinant of VEGF C protein

Research Area

Cardiovascular Research; Cell Biology

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceSf9, Insect Cells
Biological ActivityMeasured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.
PurityGreater than 90.0% as determined by SDS-PAGE.
Protein SequenceDTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH

Storage & Handling

StorageStability: Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesEach mg of VEGF-C Rat contains 50mg rAlbumin and PBS as buffer.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.

Similar Products

  • VEGF-C Rabbit Polyclonal Antibody [orb11555]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • VEGF-C Rabbit Polyclonal Antibody [orb499577]

    IF,  IHC-Fr,  IHC-P,  WB

    Equine, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Rat Vascular Endothelial Growth Factor C (VEGFC) ELISA Kit [orb776370]

    Rat

    15.63-1000 pg/mL

    6.4 pg/mL

    48 T, 96 T
  • Mouse Vascular Endothelial Growth Factor C (VEGFC) ELISA Kit [orb776372]

    Mouse

    15.63-1000 pg/mL

    5.8 pg/mL

    48 T, 96 T
  • Human Vascular Endothelial Growth Factor C (VEGFC) ELISA Kit [orb775059]

    Human

    78.13-5000 pg/mL

    33 pg/mL

    48 T, 96 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

2 μg
$ 250.00
10 μg
$ 350.00
1 mg
$ 6,710.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry