Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name VEGF C protein
Catalog Number orb429181
ConjugationUnconjugated
Target VEGF C
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.
Purity >90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source Sf9, Insect Cells.
Activity Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.
Product Description

Recombinant of VEGF C protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Reviews
Write Your Own Review
You're reviewing:VEGF C protein - orb429181
Your Rating