VEGF C Protein

SKU: orb429181

Description

Recombinant of VEGF C protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: Sf9, Insect Cells
• Biological Activity: Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.
• Protein Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH
• Purity: Greater than 90.0% as determined by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: Each mg of VEGF-C Rat contains 50mg rAlbumin and PBS as buffer.
• Disclaimer: For research use only

Alternative Names

VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.