You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb429181 |
---|---|
Category | Proteins |
Description | Recombinant of VEGF C protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 90.0% as determined by SDS-PAGE. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH |
Source | Sf9, Insect Cells |
Biological Activity | Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg. |
Storage | Stability: Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles |
Buffer/Preservatives | Each mg of VEGF-C Rat contains 50mg rAlbumin and PBS as buffer. |
Alternative names | VEGF-C, Vascular endothelial growth factor C, VRP, Read more... |
Note | For research use only |
Application notes | Cytokines And Growth Factors |
Expiration Date | 6 months from date of receipt. |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide. | |
Mammalian |