You have no items in your shopping cart.
Urocortin III, human
SKU: orb2694944
Description
Images & Validation
−
Key Properties
−| Target | CRFR |
|---|---|
| Molecular Weight | 4137.96 |
| Protein Sequence | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−- Item 1 of 1
- Item 1 of 1
Human UCN3 Protein [orb1477315]
Greater than 90% as determined by SDS-PAGE.
20.1 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Recombinant Human Urocortin-3 (UCN3) [orb1674693]
Greater than 85% as determined by SDS-PAGE.
17.7 kDa
E.coli
1 mg, 100 μg, 20 μg Recombinant Human UCN3 Protein, N-His [orb2967497]
>90% as determined by SDS-PAGE.
17.77 kDa
1 mg, 100 μg, 50 μg- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
CRFR
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Urocortin III, human (orb2694944)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days