You have no items in your shopping cart.
UIS4 Antibody
Description
Images & Validation
−| Tested Applications | IF |
|---|---|
| Dilution Range | IF:1:250-1:1,000 |
| Reactivity | Plasmodium |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide produced in E. coli. Antigen Sequence: MNPEVREKFRIGKRIKEFDDVNTPQDISLINPVENPYPENSPENSPENSPEKYIEESHKHYTKRFLEQYTEPKPSDHTYSYSPTEEAYNTHYMASDTHEDYGKLFTDEHKDEINDNIVYHDELSDLVGEGNNVYNMENKSFGPYI |
| Target | up-regulated in infective sporozoites gene 4 |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Confocal immunofluorescence analysis of liver sections of a B6 mice infected with Plasmodium Berghei ANKA parasites using UIS4 antibody
Quick Database Links
Documents Download
Request a Document
LaMonte, Gregory M. et al. Dual RNA-seq identifies human mucosal immunity protein Mucin-13 as a hallmark of Plasmodium exoerythrocytic infection Nat Commun, 10, 488 (2019)
Favuzza, Paola et al. Dual Plasmepsin-Targeting Antimalarial Agents Disrupt Multiple Stages of the Malaria Parasite Life Cycle Cell Host Microbe, 27, 642-658.e12 (2020)
UIS4 Antibody (orb11636)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review