UBLCP1 Rabbit Polyclonal Antibody

• Catalog Number: orb581832
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBLCP1
• Target: UBLCP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBLCP1
• Protein Sequence: Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV
• UniProt ID: Q8WVY7
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CPUB1
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_659486

Lanes: 1: CD4 T cell lysate from WT mice, 2: CD4 T cell lysate from WT mice treated with anti-CD3/CD28, 3: CD4 T cell lysate from WT mice treated with FK506, 4: CD4 T cell lysate from WT mice treated with anti-CD3/CD28 and FK506, 5: CD4 T cell lysate from TRPV1 KO mice, 6: CD4 T cell lysate from TRPV1 KO mice treated with anti-CD3/CD28, 7: CD4 T cell lysate from TRPV1 KO mice treated with FK506, 8: CD4 T cell lysate from TRPV1 KO mice treated with anti-CD3/CD28 and FK506, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: UBLCP1.

WB Suggested Anti-UBLCP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Thymus.