Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Ubl5 Rabbit Polyclonal Antibody

SKU: orb326091

Description

Ubl5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Ubl5. It is suitable for WB and is reactive with human, rat samples. Predicted reactivity includes Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Yeast, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetUbl5
Protein SequenceSynthetic peptide located within the following region: CNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMN
Molecular Weight8kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti beacon antibody

Similar Products

  • PIN1 Rabbit Polyclonal Antibody [orb6724]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-PIN1 (Ser71) Rabbit Polyclonal Antibody [orb1816851]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-PIN1 (Ser16) Rabbit Polyclonal Antibody [orb1816852]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PIN1 Rabbit Polyclonal Antibody [orb331219]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PIN1 Rabbit Polyclonal Antibody (HRP) [orb469187]

    IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Ubl5 Rabbit Polyclonal Antibody

Rabbit Anti-Ubl5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Ubl5 Rabbit Polyclonal Antibody

Rabbit Anti-Ubl5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Ubl5 Rabbit Polyclonal Antibody

WB Suggested Anti-Ubl5 Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Ubl5 Rabbit Polyclonal Antibody (orb326091)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry