You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb2008264 |
|---|---|
| Category | Proteins |
| Description | UBE2T,ubiquitin-conjugating enzyme E2T (putative),PIG50; HSPC150; UBE2T,ubiquitin-conjugating enzyme E2 T,ubiquitin-conjugating enzyme E2 T,ubiquitin-protein ligase T,ubiquitin carrier protein T,ubiquitin conjugating enzyme,cell proliferation-inducing gene 50 protein,HSPC150 protein similar to ubiquitin-conjugating enzyme |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV |
| UniProt ID | Q9NPD8 |
| MW | 22kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | HSPC150, PIG50 |
| Note | For research use only |
| NCBI | NP_054895 |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review