Cart summary

You have no items in your shopping cart.

UBE2D3 Rabbit Polyclonal Antibody

SKU: orb578681

Description

Rabbit polyclonal antibody to UBE2D3

Research Area

Molecular Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D3
TargetUBE2D3
Protein SequenceSynthetic peptide located within the following region: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF
Molecular Weight17kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

UBC4/5, UBCH5C, E2(17)KB3

Similar Products

  • UBE2D3 Rabbit Polyclonal Antibody [orb632301]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • UBE2D3 Rabbit Polyclonal Antibody [orb2476]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • UBE2D3 Rabbit Polyclonal Antibody [orb2953295]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • UBE2D3 Rabbit Polyclonal Antibody [orb668552]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl, 30 μl
  • UBE2D3 polyclonal antibody [orb648049]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UBE2D3 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

UBE2D3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

UBE2D3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

UBE2D3 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

UBE2D3 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

UBE2D3 Rabbit Polyclonal Antibody

Lanes: 1: 40 ng HIS-UBE2D1 protein, 2: 40 ng HIS-UBE2D2 protein, 3: 40 ng HIS-UBE2D3 protein, 4: 40 ng HIS-UBE2D4 protein, 5: 40 ng HIS-UBE2E1 protein, 6: 40 ng HIS-UBE2E2 protein, 7: 40 ng HIS-UBE2E3 protein, 8: 40 ng HIS-UBE2K protein, 9: 40 ng HIS-UBE2L3 protein, 10: 40 ng HIS-UBE2N protein, 11: 40 ng HIS-UBE2V1 protein, 12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:50000, Gene Name: UBE2D3.

UBE2D3 Rabbit Polyclonal Antibody

WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate. UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003331

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

UBE2D3 Rabbit Polyclonal Antibody (orb578681)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry