You have no items in your shopping cart.
[Tyr36]-pTH-Related Protein (1-36) (human, rat)
SKU: orb2694653
Description
Images & Validation
−![[Tyr36]-pTH-Related Protein (1-36) (human, rat)](/images/quality_badge_proteins.png)
Key Properties
−| Molecular Weight | 4309.91 |
|---|---|
| Protein Sequence | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) [orb2694088]
≥95%
4324.9
250 mg, 25 mg, 10 mg, 5 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
[Tyr36]-pTH-Related Protein (1-36) (human, rat) (orb2694653)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review