[Tyr1] -pTH (1-34), human

• Catalog Number: orb2693565
• Category: Proteins
• Description: (Tyr1)-pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
• CAS Number: 213779-10-3
• Purity: ≥95%
• MW: 4193.87
• Formula: C₁₈₉H₂₉₅N₅₅O₅₁S₂
• Target: others
• Protein Sequence: YVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
• Note: For research use only
• Expiration Date: 6 months from date of receipt.