You have no items in your shopping cart.
You have no items in your shopping cart.
![[Tyr0]-pTH-Related Protein (1-34) (human, rat)](/images/quality_badge_proteins.png)
| Catalog Number | orb2694672 |
|---|---|
| Category | Proteins |
| Description | [Tyr0]-pTH-Related Protein (1-34) (human, rat) |
| Purity | ≥95% |
| Protein Sequence | YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA |
| MW | 4180.79 |
| Formula | C189H296N58O50 |
| Note | For research use only |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review