You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694919 |
---|---|
Category | Proteins |
Description | Tyr-CRF (ovine) is a corticotropin releasing factor/hormone isolated from ovine. CRF is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin |
Target | CRFR |
Purity | ≥95% |
Protein Sequence | YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
MW | 4833.59 |
CAS Number | 83930-34-1 |
Formula | C214H348N60O65S |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |