You have no items in your shopping cart.
Tyr-CRF (ovine)
SKU: orb2694919
Description
Images & Validation
−
Key Properties
−| Target | CRFR |
|---|---|
| Molecular Weight | 4833.59 |
| Protein Sequence | YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
CRFR
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Tyr-CRF (ovine) (orb2694919)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review![[Tyr0] Corticotropin Releasing Factor, ovine](/images/quality_badge_smaill_molecules_and_tools.png)