You have no items in your shopping cart.
Cart summary
TUFM Peptide - middle region
Catalog Number: orb1997562
| Catalog Number | orb1997562 |
|---|---|
| Category | Proteins |
| Description | TUFM Peptide - middle region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 49 kDa |
| UniProt ID | Q8BFR5 |
| Protein Sequence | Synthetic peptide located within the following region: DHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYS |
| NCBI | NP_001157185.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | EFTU, C76308, C76389, EF-TuMT, 2300002G02Rik Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
