Cart summary

You have no items in your shopping cart.

TTC23 Peptide - N-terminal region

SKU: orb2001352

Description

TTC23 Peptide - N-terminal region

Images & Validation

Tested ApplicationsWB

Key Properties

Protein SequenceSynthetic peptide located within the following region: KFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHEYKQAVHELVRCVALTR

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HCC-8
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TTC23 Peptide - N-terminal region (orb2001352)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 200.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry