Cart summary

You have no items in your shopping cart.

TSLP Rabbit Polyclonal Antibody (Biotin)

TSLP Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2096722

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2096722
CategoryAntibodies
DescriptionTSLP Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Human
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW18kDa
UniProt IDQ969D9
Protein SequenceSynthetic peptide located within the following region: GCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCL
NCBINP_149024
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.