Cart summary

You have no items in your shopping cart.

TSHZ3 Peptide - middle region

TSHZ3 Peptide - middle region

Catalog Number: orb2003841

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2003841
CategoryProteins
DescriptionTSHZ3 Peptide - middle region
Tested applicationsWB
Predicted ReactivityHuman, Mouse
Form/AppearanceLyophilized powder
MW42kDa
UniProt IDQ63HK5
Protein SequenceSynthetic peptide located within the following region: VARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKV
NCBINP_065907.2
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesTSH3, ZNF537
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with TSHZ3 Rabbit Polyclonal Antibody (orb574332). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.