You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330584 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TRPV5 |
| Target | TRPV5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRPV5 |
| Protein Sequence | Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA |
| UniProt ID | Q9NQA5 |
| MW | 82kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CAT2 antibody, anti ECAC1 antibody, anti OTRP Read more... |
| Research Area | Cell Biology, Pharmacology & Drug Discovery |
| Note | For research use only |
| NCBI | NP_062815 |

Sample Type: 1-4. hRetinal pigment epithelial cells, 4 individual donors (20 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-rabbit-AP, Secondary dilution: 1:2000.

Sample Type: hRetinal pigment epithelial cells, Green: primary, Red: nuclear, Primary dilution: 1:200, Secondary Antibody: goat anti-rabbit-Alexa 488, Secondary dilution: 1:500.

WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate, TRPV5 is supported by BioGPS gene expression data to be expressed in 721_B.
FC | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
PE |
FC | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
BF488 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review