You have no items in your shopping cart.
Cart summary
Item 1 of 1
TRIM58 Antibody
Catalog Number: orb575138
| Catalog Number | orb575138 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TRIM58 |
| Target | TRIM58 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen for Anti-TRIM58 antibody is: synthetic peptide directed towards the N-terminal region of Human TRI58 |
| Protein Sequence | Synthetic peptide located within the following region: HRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKE |
| UniProt ID | Q8NG06 |
| MW | 53 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | BIA2 |
| Note | For research use only |
Sample Type: MCF7 Whole Cell, Antibody dilution: 1.0 ug/ml.
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
