You have no items in your shopping cart.
Cart summary
TRAPPC5 Peptide - N-terminal region
Catalog Number: orb2008267
| Catalog Number | orb2008267 |
|---|---|
| Category | Proteins |
| Description | TRAPPC5,trafficking protein particle complex 5,TRS31; MGC52424; TRAPPC5,trafficking protein particle complex subunit 5,trafficking protein particle complex subunit 5 |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 21kDa |
| UniProt ID | Q8IUR0 |
| Protein Sequence | MEARFTRGKSALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAEL |
| NCBI | NP_777554 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | MGC52424, TRS31 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
