Transthyretin (F87M/L110M) , Human, Recombinant

SKU: orb1401961

Description

Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. F87M/L110M TTR is an engineered variant unable to form a stable tetramer

Key Properties

• Source: Protein expressed in Escherichia coli
• MW: 13.7 kDa
• Purity: 95% by Chromatography and SDS-PAGE
• Protein Sequence: GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE

Storage & Handling

• Storage: Room temperature, avoid light exposure.
• Form/Appearance: Lyophilized 1 mg/vial
• Buffer/Preservatives: The lyophilized protein is readily soluble in PBS pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only