Transthyretin (F87M/L110M) , Human, Recombinant

SKU: orb1401961

Description

Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. F87M/L110M TTR is an engineered variant unable to form a stable tetramer

Images & Validation

−

Key Properties

−

Source	Protein expressed in Escherichia coli
Molecular Weight	13.7 kDa
Protein Sequence	GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE
Purity	95% by Chromatography and SDS-PAGE

Storage & Handling

−

Storage	Room temperature, avoid light exposure.
Form/Appearance	Lyophilized 1 mg/vial
Buffer/Preservatives	The lyophilized protein is readily soluble in PBS pH 7.4
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols