TPH1/Tryptophan Hydroxylase Antibody

SKU: orb1536237

Description

TPH1/Tryptophan Hydroxylase Antibody

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC (1:50 - 1:200), IHC-P (1:100 - 1:200), WB (1:500 - 1:2000)
• Reactivity: Human, Mouse, Rat
• Application Notes:
  Further information: The predicted MW is 50kDa/53kDa, while the observed MW by Western blot was 50kDa.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
• Target: TPH1 / Tryptophan Hydroxylase
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Concentration: 2.135 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TPH1, L-tryptophan hydroxylase, TRPH, Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TPRH, Tryptophan hydroxylase 1, TPH

Western blot analysis of extracts of various cell lines, using TPH1 antibody at 1:1000 dilution.

Quick Database Links

Gene Symbol

TPH1 / Tryptophan Hydroxylase