Cart summary

You have no items in your shopping cart.

TPH1/Tryptophan Hydroxylase Antibody

SKU: orb1536237

Description

TPH1/Tryptophan Hydroxylase Antibody

Images & Validation

Tested ApplicationsIHC, IHC-P, WB
Dilution RangeIHC (1:50 - 1:200), IHC-P (1:100 - 1:200), WB (1:500 - 1:2000)
ReactivityHuman, Mouse, Rat
Application Notes
Further information: The predicted MW is 50kDa/53kDa, while the observed MW by Western blot was 50kDa.

Key Properties

HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
TargetTPH1 / Tryptophan Hydroxylase
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration2.135 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TPH1, L-tryptophan hydroxylase, TRPH, Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TPRH, Tryptophan hydroxylase 1, TPH

Similar Products

  • TPH1/Tryptophan Hydroxylase Antibody [orb1538880]

    ELISA,  IF,  IHC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TPH1/Tryptophan Hydroxylase Antibody

Western blot analysis of extracts of various cell lines, using TPH1 antibody at 1:1000 dilution.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

TPH1/Tryptophan Hydroxylase Antibody (orb1536237)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

50 μl
$ 640.00
DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry