TPH1/Tryptophan Hydroxylase Antibody

• Catalog Number: orb1536237
• Category: Antibodies
• Description: TPH1/Tryptophan Hydroxylase Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
• Concentration: 2.135 mg/ml
• Dilution range: IHC (1:50 - 1:200), IHC-P (1:100 - 1:200), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: TPH1 / Tryptophan Hydroxylase
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: TPH1, L-tryptophan hydroxylase, TRPH, Tryptophan 5
• Note: For research use only
• Application notes: Further information: The predicted MW is 50kDa/53kDa, while the observed MW by Western blot was 50kDa.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of extracts of various cell lines, using TPH1 antibody at 1:1000 dilution.