Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Tpc1808 protein
Catalog Number orb428950
ConjugationUnconjugated
Target Tpc1808
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS.
Purity >95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source Escherichia Coli.
Product Description

Recombinant of Tpc1808 protein

Reviews
Write Your Own Review
You're reviewing:Tpc1808 protein - orb428950
Your Rating