You have no items in your shopping cart.
Cart summary
TOP3B Peptide - middle region
Catalog Number: orb1999609
| Catalog Number | orb1999609 |
|---|---|
| Category | Proteins |
| Description | TOP3B Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 77 kDa |
| UniProt ID | O95985 |
| Protein Sequence | Synthetic peptide located within the following region: YWADTVKRLLAEGINRPRKGHDAGDHPPITPMKSATEAELGGDAWRLYEY |
| NCBI | NP_001269041.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | TOP3B1 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
