TNS4 Rabbit Polyclonal Antibody

• Catalog Number: orb584765
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TNS4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 77kDa
• Target: TNS4
• UniProt ID: Q8IZW8
• Protein Sequence: Synthetic peptide located within the following region: GTGGSQAELAQSTMSMRKKEESEALDIKYIEVTSARSRCHDGPQHCSSPS
• NCBI: NP_116254
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CTEN, PP14434
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 30 ug human 293T lysate, Lane 2: 30 ug human BEL7402 cell lysate, Lane 3: 30 ug human SMMC772 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: TNS4 a.

WB Suggested Anti-TNS4 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.