Cart summary

You have no items in your shopping cart.

TMEM38A Rabbit Polyclonal Antibody (Biotin)

TMEM38A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2112586

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112586
CategoryAntibodies
DescriptionTMEM38A Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TMEM38A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW33kDa
UniProt IDQ9H6F2
Protein SequenceSynthetic peptide located within the following region: GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE
NCBINP_076979
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesTRICA, TRIC-A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.