TIP 39

SKU: orb1147031

Description

Endogenous parathyroid hormone 2 receptor agonist; Peptides.

Research Area

Metabolism Research

Key Properties

• MW: 4504.24 Da
• Purity: > 95%
• Formula: C₂₀₂H₃₂₅N₆₁O₅₄S
• Protein Sequence: H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH

Storage & Handling

• Storage: Store dry, frozen and in the dark
• Form/Appearance: Freeze dried solid
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP, TIP 39, TIP39, Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues