Cart summary

You have no items in your shopping cart.

TICAM2 Peptide - N-terminal region

TICAM2 Peptide - N-terminal region

Catalog Number: orb1999598

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999598
CategoryProteins
DescriptionTICAM2 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW44 kDa
UniProt IDQ86XR7
Protein SequenceSynthetic peptide located within the following region: GIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNT
NCBINP_001157940.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
NoteFor research use only
Expiration Date6 months from date of receipt.