You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330996 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to THPO |
Target | THPO |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human THPO |
Protein Sequence | Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS |
UniProt ID | P40225 |
MW | 35kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MGC163194 antibody, anti MGDF antibody, anti Read more... |
Note | For research use only |
NCBI | NP_000451 |
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.
WB Suggested Anti-THPO Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |