Them6 Rabbit Polyclonal Antibody

• Catalog Number: orb325332
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Them6
• Target: Them6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik
• Protein Sequence: Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG
• UniProt ID: Q80ZW2
• MW: 24kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC54796 antibody, anti 4930572J05Rik antibod
• Note: For research use only
• NCBI: NP_941009

WB Suggested Anti-4930572J05Rik Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Stomach.