You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574000 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TBX10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Porcine, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TBX10 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | TBX10 |
UniProt ID | O75333 |
Protein Sequence | Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA |
NCBI | NP_005986 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TBX7, TBX13 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Rabbit Anti-TBX10 Antibody, Catalog Number: orb574000, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Nuclear in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |