TBX10 Rabbit Polyclonal Antibody

• Catalog Number: orb574000
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBX10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Porcine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX10
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: TBX10
• UniProt ID: O75333
• Protein Sequence: Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA
• NCBI: NP_005986
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TBX7, TBX13
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Rabbit Anti-TBX10 Antibody, Catalog Number: orb574000, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Nuclear in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.