You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1479252 |
---|---|
Category | Proteins |
Description | HuR-PARP1 interaction blocker; Cell penetrating peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by hplc |
MW | 3696.9 Da |
Formula | C151H257N59O46S2 |
H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ser-Pro-Met-Gly-Val-Asp-His-Met-Ser-Gly-Leu-Ser-Gly-Val-Asn-Val-Pro-Gly-Asn-Ala-Ser-Ser-Gly-OH | |
Solubility (25°C) | Soluble in water |
Protein Sequence | YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG |
Storage | Store dry, frozen and in the dark |
Alternative names | PP370, TAT-HuR-HNS3, YGRKKRRQRRRSPMGVDHMSGLSGVNVPG Read more... |
Background | TAT-HuR-HNS3 is a cell penetrating peptide derived from the human antigen R - nucleocytoplasmic shuttling sequence (HuR-HNS) domain. HuR, also known as embryonic lethal abnormal vision-like 1 (ELAVL1) is a well characterized RNA-binding protein that increases the stability of short lived mRNAs which encode proinflammatory mediators. HuR employs its HNS domain to interact with poly(ADP-ribose) polymerase 1 (PARP1), and intervention by TAT-HuR-HNS3 interrupts this interaction, resulting in lower poly-ADP-ribosylation and decreased cytoplasmic distribution of HuR. TAT-HuR-HNS3 also blocks HuR dimerization and promotes argonaute 2-based miRNA induced silencing complex binding. TAT-HuR-HNS3 lowers the mRNA stability of proinfl ammatory mediators in TNF-α treated epithelial cells and macrophages, and decreases TNF-α induced inflammatory responses in animal lung models. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Filter by Rating