Cart summary

You have no items in your shopping cart.

TAT-HuR-HNS3

SKU: orb1479252

Description

HuR-PARP1 interaction blocker; Cell penetrating peptides.

Images & Validation

Key Properties

Molecular Weight3696.9 Da
Protein SequenceH-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ser-Pro-Met-Gly-Val-Asp-His-Met-Ser-Gly-Leu-Ser-Gly-Val-Asn-Val-Pro-Gly-Asn-Ala-Ser-Ser-Gly-OH
Purity> 95% by hplc

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
DisclaimerFor research use only

Alternative Names

PP370, TAT-HuR-HNS3, YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

TAT-HuR-HNS3 (orb1479252)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 360.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry