Cart summary

You have no items in your shopping cart.

TARM1 Rabbit Polyclonal Antibody (Biotin)

TARM1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2084950

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2084950
CategoryAntibodies
DescriptionTARM1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TARM1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW27kDa
UniProt IDB6A8C7
Protein SequenceSynthetic peptide located within the following region: PGTTSSNYSLGNFVRLGLAAVIVVIMGAFLVEAWYSRNVSPGESEAFKPE
NCBINP_001129158
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesOLT-2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.