You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576958 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAF5L |
Target | TAF5L |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAF5L |
Protein Sequence | Synthetic peptide located within the following region: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQS |
UniProt ID | O75529 |
MW | 66kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PAF65B |
Research Area | Epigenetics & Chromatin, Protein Biochemistry |
Note | For research use only |
NCBI | NP_055224 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TAF5L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.
IHC, WB | |
Canine, Human, Monkey, Rabbit | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |