TAF1C Rabbit Polyclonal Antibody

SKU: orb576781

Description

Rabbit polyclonal antibody to TAF1C

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1C
• Target: TAF1C
• Protein Sequence: Synthetic peptide located within the following region: AKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF
• Molecular Weight: 85kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SL1, TAFI95, TAFI110, MGC:39976

WB Suggested Anti-TAF1C Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. TAF1C is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

TAF1C

UniProt

Q15572

RefSeq (Protein):NP_647610