You have no items in your shopping cart.
C1orf144 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144 |
| Target | SZRD1 |
| Protein Sequence | Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN |
| Molecular Weight | 15kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−C1orf144 Rabbit Polyclonal Antibody [orb2789]
IF, IHC-Fr, IHC-P
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlC1orf144 Rabbit Polyclonal Antibody (HRP) [orb2105258]
IHC, WB
Bovine, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlC1orf144 Rabbit Polyclonal Antibody (FITC) [orb2105259]
IHC, WB
Bovine, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rabbit Anti-C1orf144 Antibody, Catalog Number: orb582706, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

Rabbit Anti-C1orf144 Antibody, Catalog Number: orb582706, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Nuclear (strong) and Cytoplasm (weak) in hepatocytes, moderate signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-C1orf144 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: RPMI 8226 cell lysate. SZRD1 is supported by BioGPS gene expression data to be expressed in RPMI 8226.
Documents Download
Request a Document
Protocol Information
C1orf144 Rabbit Polyclonal Antibody (orb582706)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



