SYT9 antibody

• Catalog Number: orb330707
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SYT9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SYT9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: SYT9
• UniProt ID: Q86SS6
• Protein Sequence: Synthetic peptide located within the following region: PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL
• NCBI: NP_783860
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ45896 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of mouse retina tissue using SYT9 antibody

Western blot analysis of human Muscle tissue using SYT9 antibody

Immunohistochemical staining of mouse retina tissue using SYT9 antibody