You have no items in your shopping cart.
SYDE1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SYDE1 |
| Target | SYDE1 |
| Protein Sequence | Synthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG |
| Molecular Weight | 80kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SYDE1 Rabbit Polyclonal Antibody (HRP) [orb2121803]
WB
Bovine, Canine, Guinea pig, Human, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlSYDE1 Rabbit Polyclonal Antibody (FITC) [orb2121804]
WB
Bovine, Canine, Guinea pig, Human, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μlSYDE1 Rabbit Polyclonal Antibody (Biotin) [orb2121805]
WB
Bovine, Canine, Guinea pig, Human, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Lanes: 1: 2 ug mouse SYDE1 transfected HEK293T lysate, 2: 15 ug untransfected HEK293T lysate, 3: 100 ug wild type mouse brain lysate, 4: 100 ug SYDE1 knock-out mouse brain lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit L-chain HRP, Secondary Antibody Dilution: 1:10000, Gene Name: SYDE1.

WB Suggested Anti-SYDE1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
SYDE1 Rabbit Polyclonal Antibody (orb578569)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
