SYDE1 Rabbit Polyclonal Antibody

• Catalog Number: orb578569
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SYDE1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYDE1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 80kDa
• Target: SYDE1
• UniProt ID: Q6ZW31
• Protein Sequence: Synthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
• NCBI: NP_149014
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 7h3, SYD1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 2 ug mouse SYDE1 transfected HEK293T lysate, 2: 15 ug untransfected HEK293T lysate, 3: 100 ug wild type mouse brain lysate, 4: 100 ug SYDE1 knock-out mouse brain lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit L-chain HRP, Secondary Antibody Dilution: 1:10000, Gene Name: SYDE1.

WB Suggested Anti-SYDE1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.