You have no items in your shopping cart.
SUR2A Antibody (PerCP)
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, IHC, WB |
|---|---|
| Dilution Range | WB (1:1000) |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2A |
| Clone No. | N319A/14 (Formerly sold as S319A-14) |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Target | SUR2A |
| Molecular Weight | 120kDa |
| Purification | Protein G Purified |
| Conjugation | PerCP |
Storage & Handling
−| Storage | Conjugated antibodies should be stored according to the product label |
|---|---|
| Buffer/Preservatives | 95.46mM Phosphate, 2.48mM MES and 2mM EDTA |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:200 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) SUR2A Antibody (D) Composite.

Western Blot analysis of Rat Brain Membrane showing detection of ~120 kDa SUR2A protein using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 μg). Load: 10 μg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~120 kDa.
Quick Database Links
UniProt Details
−NCBI Gene Details
−NCBI Reference Sequences
−| Protein | NP_001038185.1 |
|---|
Documents Download
Request a Document
Protocol Information
SUR2A Antibody (PerCP) (orb150358)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review