You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb150358 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal to SUR2A (PerCP). Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6. x (6. 1 and 6. 2). The association of four K ir6. x and four SUR subunits form an ion conducting channel commonly referred to as the K ATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir 6. x potassium channel. Hence the K ATP channel monitors the energy balance within the cell.. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | N319A/14 (Formerly sold as S319A-14) |
Tested applications | ELISA, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2A |
Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
Concentration | 1 mg/ml |
Dilution range | WB (1:1000) |
Conjugation | PerCP |
MW | 120kDa |
Target | SUR2A |
Entrez | 20928 |
UniProt ID | P70170 |
NCBI | NP_001038185.1 |
Storage | Conjugated antibodies should be stored according to the product label |
Buffer/Preservatives | 95.64mM Phosphate, 2.48mM MES and 2mM EDTA |
Alternative names | ABCC9 antibody, Sulfonylurea receptor 2 antibody, Read more... |
Note | For research use only |
Application notes | 1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. |
Expiration Date | 12 months from date of receipt. |
Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:200 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) SUR2A Antibody (D) Composite.
Western Blot analysis of Rat Brain Membrane showing detection of ~120 kDa SUR2A protein using Mouse Anti-SUR2A Monoclonal Antibody, Clone N319A/14. Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 μg). Load: 10 μg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~120 kDa.