Cart summary

You have no items in your shopping cart.

SULT1A2 Rabbit Polyclonal Antibody (FITC)

SULT1A2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2082501

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2082501
CategoryAntibodies
DescriptionSULT1A2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human ST1A2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW32kDa
UniProt IDP50226
Protein SequenceSynthetic peptide located within the following region: AKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWE
NCBIXP_006721139
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSTP2, HAST4, P-PST, ST1A2, TSPST2, P-PST 2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.